Phosphoribosyl Pyrophosphate Amidotransferase Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-52964
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PPAT
• Conjugate: Unconjugated

Product images

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - 1. Human Skin Fibroblasts (100ug) 2. HepG2 cells (20 ug) 3. HEK273 cells (20 ug) 4. HeLa skin cells(20 ug) 5. Hamster CHO K1 cells (20 ug) Primary Dilution: 1 : 5000 Secondary Antibody: Clean-Blot IP detection Reagent and Kit Secondary Dilution: 1 : 2000.

Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - HepG2 Cell Lysate, concentration 0.25ug/ml.