BXDC5 Antibody
| Name | BXDC5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80467 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human BXDC5. Peptide sequence AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RPF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: BXDC5 Antibody [NBP1-80467] - K562 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24582_BXDC5%2520Antibody-Western%2520Blot-NBP1-80467-img0001.jpg)
![Immunohistochemistry-Paraffin: BXDC5 Antibody [NBP1-80467] - Human Breast, antibody concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24583_BXDC5%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80467-img0002.jpg)