Name | SLC46A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80531 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the N terminal of human SLC46A3. Peptide sequence MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SLC46A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |