SLC46A3 Antibody
| Name | SLC46A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80531 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human SLC46A3. Peptide sequence MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC46A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC46A3 Antibody [NBP1-80531] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24671_SLC46A3-Antibody-Western-Blot-NBP1-80531-img0001.jpg)
Western Blot: SLC46A3 Antibody [NBP1-80531] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-80531] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24672_SLC46A3-Antibody-Immunohistochemistry-Paraffin-NBP1-80531-img0002.jpg)
Immunohistochemistry-Paraffin: SLC46A3 Antibody [NBP1-80531] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.