KCTD6 Antibody
| Name | KCTD6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80095 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human KCTD6. Peptide sequence: HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | KCTD6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: KCTD6 Antibody [NBP1-80095] - Transfected 293T, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14544_KCTD6%2520Antibody-Western%2520Blot-NBP1-80095-img0001.jpg)
![Immunohistochemistry-Paraffin: KCTD6 Antibody [NBP1-80095] - Human Lung Alveolar cells (indicated with arrows), 16ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14545_KCTD6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80095-img0002.jpg)