VDAC3 Antibody
| Name | VDAC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80069 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human VDAC3. Peptide sequence: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VDAC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: VDAC3 Antibody [NBP1-80069] - HT1080, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29754_VDAC3-Antibody-Western-Blot-NBP1-80069-img0003.jpg)
![Western Blot: VDAC3 Antibody [NBP1-80069] - Human Thymus lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29755_VDAC3-Antibody-Western-Blot-NBP1-80069-img0002.jpg)
![Western Blot: VDAC3 Antibody [NBP1-80069] - RPMI-8226, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29756_VDAC3%2520Antibody-Western%2520Blot-NBP1-80069-img0004.jpg)