Name | KLHL13 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-80047 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human, Rat, Horse, Rabbit |
Antigen | Synthetic peptide directed towards the N terminal of human KLHL13. Peptide sequence KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | KLHL13 |
Supplier Page | Shop |