SETD4 Antibody

Name SETD4 Antibody
Supplier Novus Biologicals
Catalog NBP1-80045
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Rabbit
Antigen Synthetic peptide directed towards the C terminal of human SETD4. Peptide sequence VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SETD4
Supplier Page Shop

Product images