ZNF786 Antibody
| Name | ZNF786 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80405 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF786. Peptide sequence MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF786 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF786 Antibody [NBP1-80405] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24510_ZNF786%2520Antibody-Western%2520Blot-NBP1-80405-img0003.jpg)
![Immunohistochemistry-Paraffin: ZNF786 Antibody [NBP1-80405] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24511_ZNF786%2520Antibody-Immunohistochemistry-Paraffin-NBP1-80405-img0002.jpg)