TM9SF1 Antibody
| Name | TM9SF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69486 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the N terminal of TM9SF1. Peptide sequence EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TM9SF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: TM9SF1 Antibody [NBP1-69486] - This Anti-TM9SF1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24272_TM9SF1-Antibody-Western-Blot-NBP1-69486-img0001.jpg)
![Immunohistochemistry: TM9SF1 Antibody [NBP1-69486] - Staining of human kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24273_TM9SF1%2520Antibody-Immunohistochemistry-NBP1-69486-img0002.jpg)