Tetraspanin-5 Antibody
| Name | Tetraspanin-5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69337 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TSPAN5(tetraspanin 5) The peptide sequence was selected from the middle region of TSPAN5. Peptide sequence ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSPAN5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Tetraspanin-5 Antibody [NBP1-69337] - This Anti-TSPAN5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29724_Tetraspanin-5-Antibody-Western-Blot-NBP1-69337-img0001.jpg)
![Immunohistochemistry: Tetraspanin-5 Antibody [NBP1-69337] - Human kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29725_Tetraspanin-5%2520Antibody-Immunohistochemistry-NBP1-69337-img0002.jpg)