MIR16 Antibody
| Name | MIR16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69654 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GDE1 The peptide sequence was selected from the N terminal of GDE1. Peptide sequence LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GDE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MIR16 Antibody [NBP1-69654] - This Anti-GDE1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14592_MIR16-Antibody-Western-Blot-NBP1-69654-img0001.jpg)
![Immunohistochemistry: MIR16 Antibody [NBP1-69654] - Staining of human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14593_MIR16%2520Antibody-Immunohistochemistry-NBP1-69654-img0002.jpg)