RAB8B Antibody
| Name | RAB8B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-68974 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RAB8B (RAB8B, member RAS oncogene family) The peptide sequence was selected from the C terminal of RAB8B. Peptide sequence RNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RAB8B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RAB8B Antibody [NBP1-68974] - The repeat Western Blot of RAB8B showed endogenous RAB8B expressed in both species. This was confirmed with GFP-tagged mRAB8B corresponding to the GFP antibody. Image submitted by Dr. Jackob Szwedo from Dr. Lupashnin's lab at the University of Arkansas.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24336_RAB8B-Antibody-Western-Blot-NBP1-68974-img0003.jpg)
Western Blot: RAB8B Antibody [NBP1-68974] - The repeat Western Blot of RAB8B showed endogenous RAB8B expressed in both species. This was confirmed with GFP-tagged mRAB8B corresponding to the GFP antibody. Image submitted by Dr. Jackob Szwedo from Dr. Lupashnin's lab at the University of Arkansas.
![Western Blot: RAB8B Antibody [NBP1-68974] - COLO205 cell lysate, antibody titration 1.0ug/ml. Gel concentration 12%.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24337_RAB8B-Antibody-Western-Blot-NBP1-68974-img0001.jpg)
Western Blot: RAB8B Antibody [NBP1-68974] - COLO205 cell lysate, antibody titration 1.0ug/ml. Gel concentration 12%.