PRODH2 Antibody
| Name | PRODH2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70682 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PRODH2(proline dehydrogenase (oxidase) 2) The peptide sequence was selected from the C terminal of PRODH2. Peptide sequence LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRODH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PRODH2 Antibody [NBP1-70682] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24859_PRODH2-Antibody-Western-Blot-NBP1-70682-img0001.jpg)
Western Blot: PRODH2 Antibody [NBP1-70682] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: PRODH2 Antibody [NBP1-70682] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24860_PRODH2-Antibody-Immunohistochemistry-Paraffin-NBP1-70682-img0002.jpg)
Immunohistochemistry-Paraffin: PRODH2 Antibody [NBP1-70682] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.