G protein beta 4 Antibody
| Name | G protein beta 4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79681 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GNB4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: G protein beta 4 Antibody [NBP1-79681] - Titration: 0.2-1 ug/ml, Positive Control: HCT15 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6916_G%2520protein%2520beta%25204%2520Antibody-Western%2520Blot-NBP1-79681-img0004.jpg)
![Western Blot: G protein beta 4 Antibody [NBP1-79681] - Primary dilution: 1:1000 Secondary dilution: 1:10000 goat-anti-rabbit](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6917_G%2520protein%2520beta%25204%2520Antibody-Western%2520Blot-NBP1-79681-img0002.jpg)