OR13C9 Antibody
| Name | OR13C9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79986 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human OR13C9. Peptide sequence IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | OR13C9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: OR13C9 Antibody [NBP1-79986] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14571_OR13C9-Antibody-Western-Blot-NBP1-79986-img0001.jpg)
Western Blot: OR13C9 Antibody [NBP1-79986] - HepG2 cell lysate, concentration 2.5 ug/ml.
![Immunohistochemistry-Paraffin: OR13C9 Antibody [NBP1-79986] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14572_OR13C9-Antibody-Immunohistochemistry-Paraffin-NBP1-79986-img0004.jpg)
Immunohistochemistry-Paraffin: OR13C9 Antibody [NBP1-79986] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Immunohistochemistry-Paraffin: OR13C9 Antibody [NBP1-79986] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14573_OR13C9-Antibody-Immunohistochemistry-Paraffin-NBP1-79986-img0002.jpg)
Immunohistochemistry-Paraffin: OR13C9 Antibody [NBP1-79986] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.