| Name | PTOV1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79384 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human PTOV1The immunogen for this antibody is PTOV1. Peptide sequence DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PTOV1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |