sFRP-3/FRZB Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79551
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence HSTQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPC.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FRZB
• Conjugate: Unconjugated