| Name | PKI-beta Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74255 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptides corresponding to the middle region of Pkib. Immunizing peptide sequence TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PKIB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |