Name | Tetraspanin-4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59438 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB ELISA IHC |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405). |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TSPAN4 |
Conjugate | Unconjugated |
Supplier Page | Shop |