Tetraspanin-4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59438
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ELISA IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405).
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TSPAN4
• Conjugate: Unconjugated

Product images

Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: Tetraspanin-4 Antibody [NBP1-59438] - Human Adult Liver Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Western Blot: Tetraspanin-4 Antibody [NBP1-59438] - GST-Teraspanin EC2 Expressed in E. coli.