YTHDF3 Antibody
| Name | YTHDF3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56303 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Dog, Guinea Pig, Rabbit, Zebrafish |
| Antigen | Synthetic peptides corresponding to YTHDF3(YTH domain family, member 3) The peptide sequence was selected from the N terminal of YTHDF3. Peptide sequence QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | YTHDF3 |
| Supplier Page | Shop |
![Western Blot: YTHDF3 Antibody [NBP1-56303] - Human 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/29145_YTHDF3-Antibody-Western-Blot-NBP1-56303-img0003.jpg)
![Western Blot: YTHDF3 Antibody [NBP1-56303] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/29146_YTHDF3%2520Antibody-Western%2520Blot-NBP1-56303-img0002.jpg)