Hemoglobin zeta Antibody

Name Hemoglobin zeta Antibody
Supplier Novus Biologicals
Catalog NBP1-56354
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to HBZ(hemoglobin, zeta) The peptide sequence was selected from the N terminal of HBZ. Peptide sequence ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene HBZ
Conjugate Unconjugated
Supplier Page Shop

Product images