FSIP1 Antibody

Name FSIP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56460
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FSIP1(fibrous sheath interacting protein 1) The peptide sequence was selected from the middle region of FSIP1 (NP_689810). Peptide sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FSIP1
Conjugate Unconjugated
Supplier Page Shop

Product images