HEMK2 Antibody
| Name | HEMK2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56486 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to N6AMT1(N-6 adenine-specific DNA methyltransferase 1 (putative)) The peptide sequence was selected from the N terminal of N6AMT1. Peptide sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | N6AMT1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: HEMK2 Antibody [NBP1-56486] - NCI-H226 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29971_HEMK2-Antibody-Western-Blot-NBP1-56486-img0003.jpg)
![Western Blot: HEMK2 Antibody [NBP1-56486] - Mouse Brain lysate, concentration 5% Milk.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29972_HEMK2-Antibody-Western-Blot-NBP1-56486-img0002.jpg)