CCT8 Antibody
| Name | CCT8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56608 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCT8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCT8 Antibody [NBP1-56608] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24542_CCT8-Antibody-Western-Blot-NBP1-56608-img0004.jpg)
Western Blot: CCT8 Antibody [NBP1-56608] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
![Western Blot: CCT8 Antibody [NBP1-56608] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young University](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24543_CCT8-Antibody-Western-Blot-NBP1-56608-img0001.jpg)
Western Blot: CCT8 Antibody [NBP1-56608] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young University
![Western Blot: CCT8 Antibody [NBP1-56608] - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24544_CCT8-Antibody-Western-Blot-NBP1-56608-img0003.jpg)
Western Blot: CCT8 Antibody [NBP1-56608] - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.