WASF3/WAVE3 Antibody
| Name | WASF3/WAVE3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54993 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Chimpanzee |
| Antigen | Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the middle region of WASF3. Peptide sequence RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | WASF3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - IAH30, DF-1, MSB-1 (fibroblasts, lymphomas, macrophage cell line), Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/1_WASF3-WAVE3-Antibody-Western-Blot-NBP1-54993-img0003.jpg)
Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - IAH30, DF-1, MSB-1 (fibroblasts, lymphomas, macrophage cell line), Antibody Titration: 0.2-1 ug/ml
![Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded) 2. MSB-1 cells (0.5x10^6 cells loaded) Primary Dilution: 1:1000 Secondary Antibody : Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1:10,000 Image Submitted By: Yongxiu Yao Institute](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/2_WASF3-WAVE3-Antibody-Western-Blot-NBP1-54993-img0002.jpg)
Western Blot: WASF3/WAVE3 Antibody [NBP1-54993] - Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded) 2. MSB-1 cells (0.5x10^6 cells loaded) Primary Dilution: 1:1000 Secondary Antibody : Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1:10,000 Image Submitted By: Yongxiu Yao Institute