WASF3/WAVE3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54992
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Chimpanzee
• Antigen: Synthetic peptides corresponding to WASF3(WAS protein family, member 3) The peptide sequence was selected from the N terminal of WASF3. Peptide sequence NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: WASF3
• Conjugate: Unconjugated

Product images

Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Titration: 0.2-1 ug/ml Positive Control: 721_B cell lysate.

Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - 1. DF-1 cells (0.5x106 cells loaded)2. MSB-1 cells (0.5x106 cells loaded) Primary Dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1 : 10,000 Image Submitted By: Yongxiu YaoInstitute for Animal Health.

Western Blot: WASF3/WAVE3 Antibody [NBP1-54992] - Sample Type: 1. DF-1 cells (0.5x10^6 cells loaded) 2. MSB-1 cells (0.5x10^6 cells loaded) Primary Dilution: 1:1000 Secondary Antibody : Goat anti-rabbit IgG (whole molecule) peroxidase Secondary Dilution: 1:10,000