COG4 Antibody

Name COG4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55199
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to COG4(component of oligomeric golgi complex 4) The peptide sequence was selected from the middle region of COG4. Peptide sequence TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene COG4
Conjugate Unconjugated
Supplier Page Shop

Product images