EXOC6 Antibody
| Name | EXOC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55430 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EXOC6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: EXOC6 Antibody [NBP1-55430] - Mouse fibroblast lysates, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29995_EXOC6%2520Antibody-Western%2520Blot-NBP1-55430-img0003.jpg)
![Western Blot: EXOC6 Antibody [NBP1-55430] - Sample Type: mouse fibroblast lusate (20ug) Primary Dilution: 1:1000 (2% milk) Secondary Dilution: 1:2000 (5% milk)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29996_EXOC6%2520Antibody-Western%2520Blot-NBP1-55430-img0002.jpg)