SLC35F2 Antibody

Name SLC35F2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59890
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC35F2(solute carrier family 35, member F2) The peptide sequence was selected from the N terminal of SLC35F2. Peptide sequence MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SLC35F2
Conjugate Unconjugated
Supplier Page Shop

Product images