Name | SLC35F2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59890 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC35F2(solute carrier family 35, member F2) The peptide sequence was selected from the N terminal of SLC35F2. Peptide sequence MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SLC35F2 |
Conjugate | Unconjugated |
Supplier Page | Shop |