Eaf6 Antibody
| Name | Eaf6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91523 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
| Antigen | Synthetic peptide directed towards the N terminal of human FLJ11730. Peptide sequence HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MEAF6 |
| Supplier Page | Shop |
Product images
![Western Blot: Eaf6 Antibody [NBP1-91523] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/29231_Eaf6%2520Antibody-Western%2520Blot-NBP1-91523-img0001.jpg)
Western Blot: Eaf6 Antibody [NBP1-91523] - Jurkat cell lysate, Antibody Titration: 0.2-1 ug/ml
![Immunohistochemistry-Paraffin: Eaf6 Antibody [NBP1-91523] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/29232_Eaf6%2520Antibody-Immunohistochemistry-Paraffin-NBP1-91523-img0002.jpg)
Immunohistochemistry-Paraffin: Eaf6 Antibody [NBP1-91523] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.