S100A13 Antibody (3A7)
| Name | S100A13 Antibody (3A7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006284-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3A7 |
| Applications | WB ELISA ICC/IF |
| Species Reactivities | Human |
| Antigen | S100A13 (NP_005970, 1 a.a. - 98 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | S100A13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: S100A13 Antibody (3A7) [H00006284-M01] - S100A13 monoclonal antibody (M01), clone 3A7 Analysis of S100A13 expression in MCF-7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/1226_S100A13-Antibody-(3A7)-Western-Blot-H00006284-M01-img0008.jpg)
Western Blot: S100A13 Antibody (3A7) [H00006284-M01] - S100A13 monoclonal antibody (M01), clone 3A7 Analysis of S100A13 expression in MCF-7.
![Immunocytochemistry/Immunofluorescence: S100A13 Antibody (3A7) [H00006284-M01] - Analysis of monoclonal antibody to S100A13 on HeLa cell. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/1227_S100A13-Antibody-(3A7)-Immunocytochemistry-Immunofluorescence-H00006284-M01-img0006.jpg)
Immunocytochemistry/Immunofluorescence: S100A13 Antibody (3A7) [H00006284-M01] - Analysis of monoclonal antibody to S100A13 on HeLa cell. Antibody concentration 10 ug/ml.
![Western Blot: S100A13 Antibody (3A7) [H00006284-M01] - Analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7.Lane 1: S100A13 transfected lysate(11.5 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/1228_S100A13%2520Antibody%2520(3A7)-Western%2520Blot-H00006284-M01-img0009.jpg)
Western Blot: S100A13 Antibody (3A7) [H00006284-M01] - Analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody (M01), clone 3A7.Lane 1: S100A13 transfected lysate(11.5 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: S100A13 Antibody (3A7) [H00006284-M01] - Detection limit for recombinant GST tagged S100A13 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/1229_S100A13-Antibody-(3A7)-Sandwich-ELISA-H00006284-M01-img0007.jpg)
Sandwich ELISA: S100A13 Antibody (3A7) [H00006284-M01] - Detection limit for recombinant GST tagged S100A13 is approximately 0.1ng/ml as a capture antibody.