FXYD2 Antibody (1C3-B3)

Name FXYD2 Antibody (1C3-B3)
Supplier Novus Biologicals
Catalog H00000486-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2b Kappa
Clone 1C3-B3
Applications WB ELISA IHC-P
Species Reactivities Human
Antigen FXYD2 (AAH05302.1, 1 a.a. - 64 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP
Purity/Format IgG purified
Description Mouse Monoclonal
Gene FXYD2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.