RPS2 Antibody (3G6)
| Name | RPS2 Antibody (3G6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006187-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3G6 |
| Applications | WB ELISA ICC/IF IHC-P |
| Species Reactivities | Human |
| Antigen | RPS2 (NP_002943 198 a.a. - 293 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APRGTGIVSAPVPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQRTQAPAVATT |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | RPS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPS2 Antibody (3G6) [H00006187-M01] - RPS2 monoclonal antibody (M01), clone 3G6. Analysis of RPS2 expression in human liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11360_RPS2%2520Antibody%2520(3G6)-Western%2520Blot-H00006187-M01-img0008.jpg)
Western Blot: RPS2 Antibody (3G6) [H00006187-M01] - RPS2 monoclonal antibody (M01), clone 3G6. Analysis of RPS2 expression in human liver.
![Immunocytochemistry/Immunofluorescence: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on HeLa cell. Antibody concentration 10 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11361_RPS2-Antibody-(3G6)-Immunocytochemistry-Immunofluorescence-H00006187-M01-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on HeLa cell. Antibody concentration 10 ug/ml.
![Immunohistochemistry-Paraffin: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.2 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/11362_RPS2-Antibody-(3G6)-Immunohistochemistry-Paraffin-H00006187-M01-img0006.jpg)
Immunohistochemistry-Paraffin: RPS2 Antibody (3G6) [H00006187-M01] - Analysis of monoclonal antibody to RPS2 on formalin-fixed paraffin-embedded human esophagus. Antibody concentration 1.2 ug/ml.