Name | SMARCD2 Antibody (2C2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00006603-M03 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2C2 |
Applications | WB ELISA |
Species Reactivities | Human, Rat |
Antigen | SMARCD2 (NP_003068 398 a.a. - 474 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | SMARCD2 |
Conjugate | Unconjugated |
Supplier Page | Shop |