DBPA Antibody (4D9)
| Name | DBPA Antibody (4D9) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008531-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 4D9 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | CSDA (NP_003642 241 a.a. - 330 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYR |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | YBX3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DBPA Antibody (4D9) [H00008531-M02] - Analysis of CSDA expression in transfected 293T cell line by CSDA monoclonal antibody (M02), clone 4D9.Lane 1: CSDA transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/27124_DBPA%2520Antibody%2520(4D9)-Western%2520Blot-H00008531-M02-img0007.jpg)
Western Blot: DBPA Antibody (4D9) [H00008531-M02] - Analysis of CSDA expression in transfected 293T cell line by CSDA monoclonal antibody (M02), clone 4D9.Lane 1: CSDA transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
![Immunohistochemistry-Paraffin: DBPA Antibody (4D9) [H00008531-M02] - Analysis of monoclonal antibody to CSDA on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/27125_DBPA-Antibody-(4D9)-Immunohistochemistry-Paraffin-H00008531-M02-img0005.jpg)
Immunohistochemistry-Paraffin: DBPA Antibody (4D9) [H00008531-M02] - Analysis of monoclonal antibody to CSDA on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
![Sandwich ELISA: DBPA Antibody (4D9) [H00008531-M02] - Detection limit for recombinant GST tagged CSDA is approximately 0.3ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/27126_DBPA-Antibody-(4D9)-Sandwich-ELISA-H00008531-M02-img0006.jpg)
Sandwich ELISA: DBPA Antibody (4D9) [H00008531-M02] - Detection limit for recombinant GST tagged CSDA is approximately 0.3ng/ml as a capture antibody.