| Name | Pbx3 Antibody (1A9) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005090-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1A9 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | PBX3 (NP_006186 342 a.a. - 434 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | PBX3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |