PDHX Antibody
| Name | PDHX Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008050-B01P |
| Prices | $359.00 |
| Sizes | 50 µg |
| Host | Mouse |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | PDHX (AAH10389.1, 1 a.a. - 501 a.a.) full-length human protein. MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA |
| Purity/Format | Protein G purified |
| Description | Mouse Polyclonal |
| Gene | PDHX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in human stomach.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/23120_PDHX-Antibody-Western-Blot-H00008050-B01P-img0007.jpg)
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in human stomach.
![Immunocytochemistry/Immunofluorescence: PDHX Antibody [H00008050-B01P] - Analysis of purified antibody to PDHX on HeLa cell. (antibody concentration 10 ug/ml)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/23121_PDHX-Antibody-Immunocytochemistry-Immunofluorescence-H00008050-B01P-img0005.jpg)
Immunocytochemistry/Immunofluorescence: PDHX Antibody [H00008050-B01P] - Analysis of purified antibody to PDHX on HeLa cell. (antibody concentration 10 ug/ml)
![Western Blot: PDHX Antibody [H00008050-B01P] - expression in transfected 293T cell line. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/23122_PDHX-Antibody-Western-Blot-H00008050-B01P-img0003.jpg)
Western Blot: PDHX Antibody [H00008050-B01P] - expression in transfected 293T cell line. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.
![Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/23123_PDHX-Antibody-Western-Blot-H00008050-B01P-img0006.jpg)
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in HepG2.
![Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in transfected 293T cell line by PDHX polyclonal antibody. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/23124_PDHX%2520Antibody-Western%2520Blot-H00008050-B01P-img0008.jpg)
Western Blot: PDHX Antibody [H00008050-B01P] - Analysis of PDHX expression in transfected 293T cell line by PDHX polyclonal antibody. Lane 1: PDHX transfected lysate(55.11 KDa). Lane 2: Non-transfected lysate.