PBX2 Antibody (2E9.)

• Supplier: Novus Biologicals
• Catalog: H00005089-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 2E9.
• Applications: WB ELISA ICC/IF Gene Silencing
• Species Reactivities: Human
• Antigen: PBX2 (NP_002577 354 a.a. - 430 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEGPGSVHSDTSN
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: PBX2
• Conjugate: Unconjugated

Product images

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - PBX2 monoclonal antibody (M01), clone 2E9 Analysis of PBX2 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of monoclonal antibody to PBX2 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 over-expressed 293 cell line, cotransfected with PBX2 Validated Chimera RNAi ( Cat # H00005089-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PBX2 monoclonal antibody (M01), clone 2E9 (Cat # H00005089-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PBX2 Antibody (2E9) [H00005089-M01] - Analysis of PBX2 expression in transfected 293T cell line by PBX2 monoclonal antibody (M01), clone 2E9.Lane 1: PBX2 transfected lysate(45.9 KDa).Lane 2: Non-transfected lysate.