IFN-epsilon Antibody
| Name | IFN-epsilon Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92018 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IFN-epsilon Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IFNE |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: IFNE1 Antibody [NBP1-92018] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4442_IFNE1-Antibody-Immunohistochemistry-NBP1-92018-img0003.jpg)
Immunohistochemistry: IFNE1 Antibody [NBP1-92018] - Staining of human rectum shows strong cytoplasmic and membranous positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: IFNE1 Antibody [NBP1-92018] - Staining of human cell line HeLa shows positivity in cytoplasm, the Golgi apparatus & nucleus but excluded from the nucleoli. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/19232_IFNE1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92018-img0004.jpg)
Immunocytochemistry/Immunofluorescence: IFNE1 Antibody [NBP1-92018] - Staining of human cell line HeLa shows positivity in cytoplasm, the Golgi apparatus & nucleus but excluded from the nucleoli. Antibody staining is shown in green.