XKR3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-33987
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: METVFEEMDEESTGGVSSSKEEIVLGQRLH
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: XKR3 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: XKR3

Product images

Immunohistochemistry-Paraffin: XKR3 Antibody [NBP2-33987] - liver

Immunohistochemistry-Paraffin: XKR3 Antibody [NBP2-33987] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.

Immunohistochemistry-Paraffin: XKR3 Antibody [NBP2-33987] - Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: XKR3 Antibody [NBP2-33987] - breast cancer