RIMKB Antibody
| Name | RIMKB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31635 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RALKAKCCEEELDFRAVVMDEVVLTIEQGNLGLRINGELITAYPQVVVVRVP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RIMKB Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RIMKLB |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RIMKB Antibody [NBP2-31635] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4556_RIMKB-Antibody-Immunohistochemistry-NBP2-31635-img0003.jpg)
Immunohistochemistry: RIMKB Antibody [NBP2-31635] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules.
![Immunohistochemistry: RIMKB Antibody [NBP2-31635] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4557_RIMKB-Antibody-Immunohistochemistry-NBP2-31635-img0001.jpg)
Immunohistochemistry: RIMKB Antibody [NBP2-31635] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity, with a granular pattern, in cells in tubules.
![Immunohistochemistry: RIMKB Antibody [NBP2-31635] - kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4558_RIMKB-Antibody-Immunohistochemistry-NBP2-31635-img0002.jpg)
Immunohistochemistry: RIMKB Antibody [NBP2-31635] - kidney
![Immunohistochemistry: RIMKB Antibody [NBP2-31635] - kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4559_RIMKB%2520Antibody-Immunohistochemistry-NBP2-31635-img0004.jpg)
Immunohistochemistry: RIMKB Antibody [NBP2-31635] - kidney