SLC45A1 Antibody
| Name | SLC45A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31563 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: FSSPISPPSPLTPKYGSFISRDSSLTGISEFASSFGTANIDSVLIDCFTGGHDSYLAIPGSVPRPPISVSFP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC45A1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC45A1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - kidney](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4587_SLC45A1-Antibody-Immunohistochemistry-NBP2-31563-img0005.jpg)
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - kidney
![Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Immunohistochemical staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4588_SLC45A1-Antibody-Immunohistochemistry-NBP2-31563-img0003.jpg)
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Immunohistochemical staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
![Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Immunohistochemical staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4589_SLC45A1-Antibody-Immunohistochemistry-NBP2-31563-img0004.jpg)
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - Immunohistochemical staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
![Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - lung cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4590_SLC45A1%2520Antibody-Immunohistochemistry-NBP2-31563-img0006.jpg)
Immunohistochemistry: SLC45A1 Antibody [NBP2-31563] - lung cancer