FBXW10 Antibody
| Name | FBXW10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33651 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PMIIRSRFSGSLKGGDQVTSSIERAVCSTGPLTSMQVIKPNRMLAPQVGTATLSLKKERPRIYTALD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FBXW10 Protein |
| Description | Rabbit Polyclonal |
| Gene | FBXW10 |
| Supplier Page | Shop |
Product images
![Western Blot: FBXW10 Antibody [NBP2-33651] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4602_FBXW10%2520Antibody-Western%2520Blot-NBP2-33651-img0003.jpg)
Western Blot: FBXW10 Antibody [NBP2-33651] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
![Immunohistochemistry-Paraffin: FBXW10 Antibody [NBP2-33651] - lymph node](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4603_FBXW10-Antibody-Immunohistochemistry-Paraffin-NBP2-33651-img0002.jpg)
Immunohistochemistry-Paraffin: FBXW10 Antibody [NBP2-33651] - lymph node
![Immunohistochemistry-Paraffin: FBXW10 Antibody [NBP2-33651] - Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4604_FBXW10-Antibody-Immunohistochemistry-Paraffin-NBP2-33651-img0001.jpg)
Immunohistochemistry-Paraffin: FBXW10 Antibody [NBP2-33651] - Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.