PCYOX1L Antibody

Name PCYOX1L Antibody
Supplier Novus Biologicals
Catalog NBP1-81121
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:LYQVAYENEVGNSSDFYDIVVIATPLHLDNSSSNLTFAGFHPPIDDVQGSFQPTVVSLVHGYLNSSYFGFPDPK
Purity/Format Immunogen affinity purified
Blocking Peptide PCYOX1L Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PCYOX1L
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.