G3BP2 Antibody
| Name | G3BP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82977 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | G3BP2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | G3BP2 |
| Supplier Page | Shop |
Product images
![Western Blot: G3BP2 Antibody [NBP1-82977] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/25754_G3BP2%2520Antibody-Western%2520Blot-NBP1-82977-img0006.jpg)
Western Blot: G3BP2 Antibody [NBP1-82977] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82977] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/25755_G3BP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82977-img0005.jpg)
Immunocytochemistry/Immunofluorescence: G3BP2 Antibody [NBP1-82977] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/25756_G3BP2-Antibody-Immunohistochemistry-Paraffin-NBP1-82977-img0001.jpg)
Immunohistochemistry-Paraffin: G3BP2 Antibody [NBP1-82977] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.