CaMKV Antibody
| Name | CaMKV Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82660 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLSGNPPFYEEVEEDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGVCAQIEKNFARAKW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CaMKV Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CAMKV |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CaMKV Antibody [NBP1-82660] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19399_CaMKV-Antibody-Western-Blot-NBP1-82660-img0007.jpg)
Western Blot: CaMKV Antibody [NBP1-82660] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
![Immunocytochemistry/Immunofluorescence: CaMKV Antibody [NBP1-82660] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytokinetic bridge.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19400_CaMKV%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82660-img0008.jpg)
Immunocytochemistry/Immunofluorescence: CaMKV Antibody [NBP1-82660] - Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cytokinetic bridge.
![Immunohistochemistry-Paraffin: CaMKV Antibody [NBP1-82660] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19401_CaMKV-Antibody-Immunohistochemistry-Paraffin-NBP1-82660-img0002.jpg)
Immunohistochemistry-Paraffin: CaMKV Antibody [NBP1-82660] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
![Western Blot: CaMKV Antibody [NBP1-82660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19402_CaMKV-Antibody-Western-Blot-NBP1-82660-img0006.jpg)
Western Blot: CaMKV Antibody [NBP1-82660] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: CaMKV Antibody [NBP1-82660] - Staining of human cell line A-431 shows positivity in centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/19403_CaMKV-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82660-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CaMKV Antibody [NBP1-82660] - Staining of human cell line A-431 shows positivity in centrosome.