BDH2 Antibody
| Name | BDH2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32713 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BDH2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BDH2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BDH2 Antibody [NBP2-32713] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15905_BDH2-Antibody-Western-Blot-NBP2-32713-img0006.jpg)
Western Blot: BDH2 Antibody [NBP2-32713] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
![Immunocytochemistry/Immunofluorescence: BDH2 Antibody [NBP2-32713] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15906_BDH2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32713-img0005.jpg)
Immunocytochemistry/Immunofluorescence: BDH2 Antibody [NBP2-32713] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
![Immunohistochemistry: BDH2 Antibody [NBP2-32713] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15907_BDH2-Antibody-Immunohistochemistry-NBP2-32713-img0003.jpg)
Immunohistochemistry: BDH2 Antibody [NBP2-32713] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.