ARMC3 Antibody
| Name | ARMC3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32703 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ARMC3 Protein |
| Description | Rabbit Polyclonal |
| Gene | ARMC3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - bronchus](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4922_ARMC3-Antibody-Immunohistochemistry-NBP2-32703-img0003.jpg)
Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - bronchus
![Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4923_ARMC3-Antibody-Immunohistochemistry-NBP2-32703-img0001.jpg)
Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
![Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4924_ARMC3-Antibody-Immunohistochemistry-NBP2-32703-img0002.jpg)
Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
![Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4925_ARMC3%2520Antibody-Immunohistochemistry-NBP2-32703-img0004.jpg)
Immunohistochemistry: ARMC3 Antibody [NBP2-32703] - breast cancer