DOK6 Antibody
| Name | DOK6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32609 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: WHHITRQNSVGEIYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DOK6 Protein |
| Description | Rabbit Polyclonal |
| Gene | DOK6 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: DOK6 Antibody [NBP2-32609] - cerebellum](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4954_DOK6-Antibody-Immunohistochemistry-NBP2-32609-img0004.jpg)
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - cerebellum
![Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4955_DOK6-Antibody-Immunohistochemistry-NBP2-32609-img0002.jpg)
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
![Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4956_DOK6-Antibody-Immunohistochemistry-NBP2-32609-img0003.jpg)
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - Immunohistochemical staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
![Immunohistochemistry: DOK6 Antibody [NBP2-32609] - lymphoma](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4957_DOK6%2520Antibody-Immunohistochemistry-NBP2-32609-img0005.jpg)
Immunohistochemistry: DOK6 Antibody [NBP2-32609] - lymphoma