Clusterin-like 1/CLUL1 Antibody
| Name | Clusterin-like 1/CLUL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32608 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALH |
| Description | Rabbit Polyclonal |
| Gene | CLUL1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4958_CLUL1-Antibody-Immunohistochemistry-NBP2-32608-img0005.jpg)
Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - liver
![Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4959_CLUL1-Antibody-Immunohistochemistry-NBP2-32608-img0003.jpg)
Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4960_CLUL1-Antibody-Immunohistochemistry-NBP2-32608-img0004.jpg)
Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/4961_CLUL1%2520Antibody-Immunohistochemistry-NBP2-32608-img0006.jpg)
Immunohistochemistry: CLUL1 Antibody [NBP2-32608] - breast cancer